PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00508.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 133aa    MW: 14860.6 Da    PI: 5.0038
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00508.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1451.7e-45498397
             NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                      e++++lPianv+r+mkk+lP  ak+s++ake +q+c+sefi fvt+easd+c++e+rkt+ngdd++wal++lGf++y e++  yl+++r +e+e+
  Migut.O00508.1.p  4 EHEKMLPIANVGRMMKKILPPSAKVSREAKERMQQCASEFICFVTGEASDRCHKENRKTVNGDDICWALSSLGFDNYSEAMLRYLQNFRGFEREN 98
                      7899****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.2E-433115IPR009072Histone-fold
SuperFamilySSF471132.84E-347112IPR009072Histone-fold
PfamPF008086.2E-24972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-153654No hitNo description
PRINTSPR006152.2E-155573No hitNo description
PRINTSPR006152.2E-157492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MSDEHEKMLP IANVGRMMKK ILPPSAKVSR EAKERMQQCA SEFICFVTGE ASDRCHKENR  60
KTVNGDDICW ALSSLGFDNY SEAMLRYLQN FRGFERENAN QSNNCKANSG EVEKDEGSIC  120
GDISAPSFDF GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-35492391Transcription factor HapC (Eurofung)
4g92_B5e-35492391Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847412.14e-96PREDICTED: nuclear transcription factor Y subunit B-5-like
RefseqXP_012857060.14e-96PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822482e-46NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A022QM271e-77A0A022QM27_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_14s0060g02660.t013e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-47nuclear factor Y, subunit B5